PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.255900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 247aa    MW: 29008.2 Da    PI: 9.5493
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.255900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.11.9e-181764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll ++v+ +G g+W+++ar  g++R +k+c++rw +yl
   Cucsa.255900.1 17 KGPWTAEEDRLLMEYVRIYGEGRWNSVARLAGLKRNGKSCRLRWVNYL 64
                     79********************************************97 PP

2Myb_DNA-binding51.91.7e-1670114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
   Cucsa.255900.1  70 RGQITPHEESIILELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 114
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.911268IPR017930Myb domain
SuperFamilySSF466893.04E-3016111IPR009057Homeodomain-like
SMARTSM007175.5E-161666IPR001005SANT/Myb domain
PfamPF002497.0E-171764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-241871IPR009057Homeodomain-like
CDDcd001671.10E-101964No hitNo description
PROSITE profilePS5129419.3569119IPR017930Myb domain
SMARTSM007171.4E-1469117IPR001005SANT/Myb domain
PfamPF002499.8E-1470114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2472118IPR009057Homeodomain-like
CDDcd001672.91E-974115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MVGHWSWGLM EDEVWRKGPW TAEEDRLLME YVRIYGEGRW NSVARLAGLK RNGKSCRLRW  60
VNYLRPDLKR GQITPHEESI ILELHARWGN RWSTIARSLP GRTDNEIKNY WRTHFKKKAK  120
DSSDANGKAK ARLLRRQQFH QQQLQQQQQQ QQFNPTEMNK IMALLEEQHD KNNNKSETLS  180
SSSASEAEKK QSISNFYTQT TDNNEQSLTS ELINNNVFVL PEMLSEGLDV GWAMELGGYN  240
PWQWQPX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-281711927128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818481e-174LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132601e-174LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004134395.20.0PREDICTED: transcription factor MYB24-like
TrEMBLR0GP774e-88R0GP77_9BRAS; Uncharacterized protein
STRINGGLYMA10G26681.18e-83(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.12e-74myb domain protein 79